Product overview
Specifications
Specifications are available from the supplier on request.
Browse subcategories and discover relevant products and verified suppliers.
Agricultural FibersBamboo Fiber · Banana Fiber · Bristle Coir Fibre
›
Agriculture SeedsAmbrette Seeds · Bajra Seeds · Barley Seeds
›
Agro Products1121 Basmati Rice · 1121 Sella Rice · 1509 Rice
›
AquacultureAcrylic Aquarium · Ammonia Chiller · Animal Health Care Products
›
Baked GoodsBread · Chocolate Chip Cookies · Cookies
›
BeveragesAgriculture Seeds · Almond Seed · Amla Juice
›
CondimentsAmla Murabba · Amla Pickles · Apple Jam
›
Confectionery ProductsActive Yeast · Almond Chocolates · Amla Candy
›
Dairy ProductsBaby Milk Powder · Butter Milk Powder · Chocobar Ice Cream
›
Dry Fruits & NutsAlmond Kernel · Almond Nuts · Black Raisins
›
Edible OilsBabchi Oil · Borage Oil · Canola Oil
›
Fertilizers & Soil AdditivesAgricultural Fertilizers · Amino Acid Fertilizer · Amino Acid Granules
›
Food Additives And ColorsApple Cider Vinegar · Biscuit Flour Improver · Butter Flavor
›
Food ProductsBarley Grass · Corn Flour · Fresh Wheat Flour
›
Fresh Flowers, Plants & TreesAglaonema Plant · Aloe Vera Plant · Areca Leaf
›
Fruits & VegetablesAlphonso Mango Pulp · Alphonso Mangoes · Amla
›
Browse subcategories and discover relevant products and verified suppliers.
Animal ClothingAustralian Saddles · Browband · Cat Collars
›
BagsAgricultural Bags · Air Bubble Bags · Aluminum Bags
›
Bath LinenAprons · Bamboo Towel · Bath Towels
›
BeachwearCotton Printed Pareos · Designer Womens Beachwear · Joggers
›
Blankets And QuiltsAcrylic Mink Blankets · Baby Blankets · Fire Blankets
›
Caps & HatsAdidas Cap · Beret Caps · Bucket Hats
›
Casual WearArmy T Shirts · Beaded Dresses · Blue Jeans
›
Coasters & Napkin RingsBrass Napkin Rings · Coaster Holder · Jute Coasters
›
CurtainsBamboo Curtain · Bedroom Curtains · Cotton Curtains
›
Embroidered GarmentsChanderi Silk Suit · Chikan Dress Material · Designer Embroidered Kurtis
›
Fashion GarmentsBeaded Garments · Cotton Silk · Ladies Silk Dress
›
FootwearArmy Boots · Baby Sandals · Baby Shoes
›
HammockHammock Swing Chair
›
Hand Gloves & MittensCotton Gloves · Hand Gloves · Hosiery Hand Gloves
›
Industrial Clothing & Work WearAluminized Fire Proximity Suit · Chemical Protection Suit · Chemical Suit
›
Jute ApparelHandmade Jute Bags · Jute Bags · Jute Drawstring Bag
›
Browse subcategories and discover relevant products and verified suppliers.
Aircraft ComponentsAeronautical Instruments · Aerospace Alloys · Aerospace Equipment
›
Auto Electrical SystemAc Led Bulb · Aluminum Led Bulb · Ambrane Power Bank
›
Auto Equipment & Repair Tools3D Wheel Alignment Machine · Auto Cleaning Equipment · Auto Washing Brush
›
Auto Exterior AccessoriesCar Alloy Wheels · Driving Helmets · Roof Carrier
›
Auto Interior AccessoriesAuto Electrical Accessories · Automotive Window Film · Carnauba Wax
›
Auto PartsAir Intake Parts · Auto Bearings · Auto Engine Parts
›
Automobile Repairing And MaintenancePetrol Pumps Services
›
Automotive Body Coach BuildingAutomotive Body Parts · Motorcycle Air Filter · Truck Parts
›
Automotive Tools & ComponentAutomatic Car Wash System · Automotive Components · Front Wheel Hubs
›
Bicycles & RickshawsAuto Wheel Rims · Bicycle Frame Parts · Bicycle Frames
›
Braking SystemsBending Brake · Bicycle Brake Cable · Bpl Kit
›
Car Parts And AccessoriesCar Accessories · Car Door Handles · Car Fans
›
Carts, Trucks & Commercial VehiclesAgricultural Tractor · Concrete Placer · Electric Vehicles
›
Oils & LubricantsAutomotive Grease · Automotive Lubricants · Automotive Oils
›
Seals, Oil Seals & Industrial SealsCartridge Seal · Dam Gate Seals · Hydraulic Seals
›
Suspension System & ComponentsAntacid Suspensions · Bearing Parts · Car Suspension System
›
Browse subcategories and discover relevant products and verified suppliers.
Aloe Vera ProductsAcne Soap · Aloe Vera Cosmetics · Aloe Vera Gel
›
Ayurvedic ConsultantAcupressure Massage · Alternate Medicine Services · Ayurvedic Medications
›
Ayurvedic MedicinesAcacia Honey · Amoxicillin Capsule · Antidiabetic Drugs
›
Ayurvedic ProductsAkarkara · Alfalfa Powder · Aloe Vera Extract
›
Browse subcategories and discover relevant products and verified suppliers.
Architecture & InteriorsConstruction Equipments Hiring Services · Expansion Joint Filling · Flooring Services
›
Auto ConsultantTrade Finance Service
›
Business Support ServicesAutomated Data Entry · Data Analysis · Loan Processing Service
›
Cad Cam Services3D Cad Modelling Services
›
Computer ServicesCar Driving Simulator · Ebooks · Furniture Design Service
›
Engineering Services3D Rapid Prototyping Service · Acp Sheet Glazing Service · Anemia Treatment Service
›
Entertainment ServicesAlternate Energy Solutions
›
Farming & Agricultural ConsultantAbrasive Blasting Service · Agri Business Consultancy · Agricultural Land Development
›
Industrial ServicesAluminum Bronze Scrap · Aluminum Wire Scrap · Chrome Plating
›
Maintenance ServicesLpg Tank Installation · Safety Equipment Services · Welding Machine Service
›
Medical ConsultantCardiologists
›
Packaging ServicesCustomize Packages Service · Heavy Machinery Packaging Services
›
Printing ServicesAluminum Nameplates · Challan Book Printing Services · Digital Printing Service
›
Real EstateAir Ventilator · Drafting Services · Horticulture Services
›
Warehousing & StorageCold Storage Room
›
Browse subcategories and discover relevant products and verified suppliers.
AcidsAcetic Acid (GNFC) · Acetic Acid Glacial · Acetic Glacial Acid
›
AgrochemicalsAnti Mosquito Chemical · Azospirillum · Azotobacter
›
Catalysts & Absorbents4 Amino 1 2 4-Triazole · Absorbents · Adipic Acid
›
Chemical CompoundsAcetonitrile · Acrylamide · Ammonium Bromide
›
Dyes & PigmentsAcid Blue Dyes · Acid Dyes · Acid Orange 7
›
ExplosivesAmmonium Nitrate · Bcaa Powder · Bhringraj Powder
›
Industrial ChemicalsAdhesive Chemical · Agarbatti Chemicals · Agro Chemicals
›
Inorganic ChemicalCalcium Chloride · Calcium Fluoride · Calcium Oxide
›
Medical And Specialty GasesArgon Gas Cylinder · Empty Gas Cylinders · Hydrogen Gas Cylinder
›
Organic ChemicalCalcium Acetate · Calcium Hydride · Dextrose
›
Paint & Coating ChemicalAcrylic Distemper Paint · Acrylic Paints · Acrylic Putty
›
Pesticides, Insecticides And HerbicidesBio Insecticides · Biofungicides · Biopesticides
›
PetrochemicalsBitumen · Bitumen Emulsion · Cashew Nut Shell Cake
›
Plastic Granules & Raw MaterialsHdpe Granules · Polystyrene Plastic Material · Polystyrene Polymers
›
PolymersHdpe · Liquid Rubber · Plasticizer
›
ResinAcrylic Emulsion · Alkyd Resins · Myrrh Gum
›
Browse subcategories and discover relevant products and verified suppliers.
AcousticsAcoustic Foam · Acoustical Ceiling Tiles · Perforated Acoustic Panels
›
Awnings ShedsCanopies · Frp Canopy · Steel Shelter
›
Bath AppliancesAcrylic Bathroom Sets · Angle Cock · Automatic Aerosol Dispenser
›
Building HardwareAluminium Fence · Aluminium Handles · Aluminum Bolts
›
Building MaterialsAluminium Beam · Armstrong Ceiling Tiles · Birla Cement
›
Doors & WindowsAcoustic Metal Doors · Aluminium Door Fittings · Aluminium Door Stopper
›
False Ceiling And Roofing MaterialsCement Corrugated Sheet · Coated Sheets · Color Profile Sheet
›
Geomembranes & Pond LinersEpdm Membrane · Hdpe Membrane · Pond Liners
›
Hardware FittingsAluminium Channels · Aluminium Nameplates · Aluminum Angle
›
Pipes And TubeAir Eliminators · Alloy Steel Pipe Fittings · Banjo Tee
›
Prefabricated & Portable BuildingsFrp Toilet Block · Green House Structure · Greenhouse
›
Sanitary Ware & FittingsBathroom Sinks · Kitchen Sinks · Plumbing Traps
›
Scaffolding And Scaffolding PartsScaffolding Clamp · Scaffolding Top Cup · Scaffoldings
›
Stained, Etched & Laminated GlassBrass Glass · Copper Glass · Decorative Glasses
›
Stairs, Newels & BalustersMarble Staircase · Pipe Railings · Railing Accessories
›
TilesCarpet Tile · Ceramic Floor Tiles · Ceramic Parking Tile
›
Browse subcategories and discover relevant products and verified suppliers.
Air ConditioningAir Chiller · Air Circulators · Air Conditioning Equipment
›
Alarm SystemAbc Fire Extinguisher · Co2 Fire Extinguisher · Fire Control Devices
›
Audio Video SystemBluetooth Headsets · Digital Earphones · Digital Flat Panel
›
Auto ElectricalAutomobile Electronics · Brass Electrical Components · Electrical Components
›
Biometrics & Access Control DevicesBarcode Id Card · Biometric Attendance Machine · Biometric Attendance System
›
Cable & WireAluminium Perforated Sheets · Brass Cable Glands · Brass Cables
›
Calculating DevicesOffice Calculator
›
ChargersHic a voluptatibus n · Solar Portable Charger
›
Clothes IronsElectric Irons
›
Computer AccessoriesKeyboard Accessories · Laptop Accessories
›
Computer Stationery And ConsumablesComputer Accessories · Ink Cartridge · Pen Drive
›
Computer SystemsDell Used Laptop · Digital Readout System · Hp Laptop
›
Computers PeripheralsComputer Mouse · Computer Projectors · Gaming Mouse
›
Consumer ElectronicsAc Filters · Air Cooling Machine · Air Dehumidifier
›
Electric FansAir Fan · Centrifugal Air Blowers · Cooling Fan Blade
›
Electrical AccessoriesCommercial Vacuum Cleaners · Electric Power Saver · Heavy Duty Vacuum Cleaner
›
Browse subcategories and discover relevant products and verified suppliers.
Biomass And BiofuelsBio Mass Plant · Biodiesel · Biofuel Briquettes
›
Energy StorageAmaron Ups Battery · Battery Packs · Battery Tester
›
Petroleum ProductsBonny Light Crude Oil · Chafing Fuel · Crude Edible Oil
›
Solar Power ProductsCommercial Solar Panel · Luminous Solar Panels · Solar Batteries
›
Browse subcategories and discover relevant products and verified suppliers.
AccessoriesAcrylic Bracelet · Beaded Tiara · Beanie Cap
›
BanglesAcrylic Bangles · Acrylic Crystal Bangles · Acrylic Fashion Bangles
›
Bath ProductsBath Salts · Bath Soaps · Handmade Bath Soaps
›
BeadsAgate Beads · Crystal Gemstone · Faceted Gemstone Bead
›
Beauty EquipmentAutomatic Thermal Massage Bed · Barber Scissor · Beard Comb
›
Body FragrancesAttar · Detergent Fragrances · Incense Stick Fragrances
›
BraceletsBeaded Bracelets · Crystal Bangle Bracelet · Pearl Silver Bracelets
›
Cosmetic & Makeup ProductsAir Fresheners · Alcohol Hand Sanitizer · Amenity Kit
›
Diamond JewelleryBlack Diamond · Blue Diamond · Cvd Diamond
›
EarringsDesigner Earrings · Designer Kundan Earrings · Kundan Earrings
›
GemstonesAgate Stone · Citrine Stone · Druzy Gemstone
›
Gold-JewelleryArtificial Nose Pins · Bullion Gold Bars · Designer Gold Rings
›
Jewelry AccessoriesAd Necklace Set · American Diamond Jewellery · American Diamond Necklace
›
Lanyards, Badges, Emblems & MotifsCar Emblems · Cloth Badge · Emblems
›
Leather BeltsBelt Straps · Canvas Belt · Clothing Belts
›
NecklacesGemstone Rosary Necklace
›
Browse subcategories and discover relevant products and verified suppliers.
Antique FurnitureAntique Beds · Antique Chairs · Antique Dining Table
›
Baby FurnitureAir Mattresses
›
Bar FurnitureBar Chair · Bar Stool · Bar Table
›
Bathroom FurnitureBathroom Corner Shelf · Bathroom Shelf · Bathroom Towel Rack
›
Bedroom FurnitureBaby Bedding Set · Bed Cushion Covers · Bed Linen
›
Commercial Use FurnitureAirport Waiting Chair · Auditorium Chair · Cafe Chairs
›
Dining Room FurnitureDining Chairs · Dining Set · Silver Dining Table
›
Furniture AccessoriesAgate Table Top · Apparel Rack · Chair Parts
›
Glass FurnitureGlass Rack
›
Home FurnitureAcrylic Chair · Armless Chair · Bamboo Chicks
›
Institutional FurnitureAttendant Bed · Bowl Stand · Commode Chairs
›
Kitchen FurnitureChef Caps · Kitchen Aprons · Kitchen Chairs
›
Leather FurnitureLeather Sofa Set
›
Living Room FurnitureShoe Racks · Sofa Cum Bed · Sofa Set
›
Metal FurnitureBrass Furniture · Cast Iron Garden Benches · Centre Table
›
Outdoor FurnitureAgro Shade Net · Folding Commode Chair · Frp Garden Bench
›
Browse subcategories and discover relevant products and verified suppliers.
Acrylic CraftsAcrylic Board · Acrylic Letters
›
Antiques & CollectiblesAntique Bookshelf · Antique Brass Floor Lamps · Antique Collectibles
›
BalloonsAdvertising Balloons · Advertising Sky Balloons · Inflatable Advertising Balloon
›
Bamboo CraftsBamboo Baskets · Hanging Wind Chimes · Pvc Floorings
›
Bead CraftsJewelry Beads · Rosary Bead
›
Bone, Horn & Shell CraftsBone Ball · Bone Boxes · Buffalo Horn
›
Brass HandicraftsAntique Brass Boxes · Antique Brass Vases · Art Photo Frame
›
Candle StandsCandle Holder · Candle Holder Set · Decorative Candle Jar
›
Ceramic & Clay DecorativesCeramic Bowls · Ceramic Crockery · Ceramic Cups
›
Christmas DecorationsAquarium Ornament · Christmas Decorative Ball · Christmas Items
›
ClocksAlarm Table Clocks · Antique Clocks · Antique Table Clock
›
Decorative CandlesAluminium Lamp Holder · Antique Candle Stands · Baby Cradle
›
GiftsAcrylic Products · Artificial Flowers · Award Trophies
›
Glass HandicraftsGlass Bottles · Glass Flower Vases · Glass Jar
›
Glass ProductsCellulose Fibre · Chopped Mat · Fiberglass Mesh
›
Holiday DecorationsBirthday Caps · Fast Food Stall · Rangoli Colors
›
Browse subcategories and discover relevant products and verified suppliers.
Boilers & FurnaceIndustrial Boilers · Steam Boilers · Water Treatment Systems
›
Chemical MachineryAlcohol Distillation Plant · Biodiesel Plants · Biodiesel Production Plant
›
Cleaning MachinesBacteria Filter · Clean Room Panels · Cleanroom Tables
›
Cnc MachineryCenter Lathe Machine · Cnc Bending Machine · Cnc Cutting Machine
›
Coating & Finishing EquipmentAirless Painting Machine · Airless Shot Blasting Machine · Blending Equipment
›
Construction MachineryAsphalt Batch Mix Plant · Asphalt Hot Mix Plants · Batching Plant Spare Parts
›
Control Systems & EquipmentChange Over Panel Boards · Control Panel Boards · Digital Timer
›
Cooling & Heat Transfer EquipmentCooling Tower Spare · Cooling Towers · Finned Tubes
›
Cutting MachinesAir Die Grinders · All Geared Lathe Machine · Aluminum Cutting Machine
›
Dairy MachineryBakery Machinery · Bread Making Machine · Commercial Freezer
›
Die Casting MachinesGravity Casting Machine
›
Drilling, Boring & Mining ServicesJig Milling Machine · Pile Drilling Machine · Radial Drill Machines
›
Dyeing & PrintingDigital Textile Printing · Polyester Printing · T-Shirt Printing Services
›
Extractors & Refining MachinesMetal Recovery Unit
›
Extrusion MachinesExtruders · Plastic Sheet Extrusion Machine
›
Fastener MachineryInstant Noodle Making Machine · Muri Making Machine · Noodles Making Machine
›
Browse subcategories and discover relevant products and verified suppliers.
Bar AccessoriesBar Counter · Beer Mug · Copper Beer Mug
›
Cooking UtensilsCookware Set · Frying Pan · Kitchen Basket
›
Dinnerware & ServewareAluminium Bowls · Areca Leaf Plates · Glass Tumblers
›
Disposable ProductsAreca Leaf Bowl · Areca Palm Leaf Plates · Disposable Bowls
›
Food Storage Boxes & JarsApple Tray · Dustbins · Fire Buckets
›
Glassware ManufacturersGlass Set
›
Home Cleaning ProductsAcrylic Dry Mop · Air Intake Cleaner · Antibacterial Wet Wipe
›
KitchenwareAluminium Casserole · Aluminium Dish · Aluminium Pressure Cooker
›
Lpg Cylinders & RegulatorsCng Cylinder · Gas Mantles
›
Pans & BakewareCake Tray · Silicone Mat
›
Safety Matches & Match BoxesSafety Matches
›
Spoon & KnifeChef Knives · Kitchen Knife Set · Vegetable Peeler
›
Teaware & AccessoriesCeramic Coffee Mugs · Coffee Mugs · Coffee Set
›
Browse subcategories and discover relevant products and verified suppliers.
Browse subcategories and discover relevant products and verified suppliers.
Aluminium ProductsAc Boxes · Acp Sheets · Alum Powder
›
Brass & Brass ProductsBrass Adapters · Brass Fittings · Brass Gas Fittings
›
Coal, Carbon & GraphiteActivated Carbon · Activated Carbon Powder · Anthracite Coal
›
Cobbles & PebblesGranite Cobblestone · Landscaping Stones · Sandstone Cobbles
›
Copper & Copper ProductsBrass Parts · Brass Precision Parts · Copper Cathodes
›
Granite & MarbleAgaria White Marble · Black Galaxy Stone · Black Granite
›
Iron & Iron ProductsCast Iron Plates · Iron Alloys · Iron Boxes
›
LimestoneLimestone Chips · Limestone Lumps · Limestone Tiles
›
Metal ProductsAcid Scrubber · Alloy Casting · Alloy Steel Ingots
›
Mica & Mica ProductsCalcined Mica · Mica Flakes · Mica Powder
›
Mineral & Metal OresAluminium Ores · Chromite Ore · Iron Ore Lump
›
MineralsAlumina Powder · Amorphous Graphite · Ball Clay
›
Nickel & Nickel ProductsNickel Pipe · Nickel Powders · Pure Nickel
›
Statues & SculpturesStone Sculptures
›
Steel & Steel ProductsCold Finished Steel · Color Coated Sheets · Galvanized Iron Steel
›
Stone Tiles & FlooringsArtificial Stone · Basalt Stones · Beach Pebble Stone
›
Browse subcategories and discover relevant products and verified suppliers.
Animal ProductsAnimal Cattle Feed · Animal Feed Supplement · Animal Feeder
›
Baby Care ProductsAutomatic Baby Cradle · Baby Body Oils · Baby Bottle Covers
›
Body Care ProductsBaby Beds · Baby Care Products · Body Care Lotion
›
Ear Care ProductsEar Drops · Tulsi Drops
›
Essential OilsAgarwood Oil · Angelica Root Oil · Aniseed Oil
›
Eye Care ProductsAchromatic Lenses · Anti Reflection Lenses · Auto Refractometer
›
Hair Care ProductsAlmond Oil · Amla Hair Oil · Bhringraj Hair Oil
›
Health Care ProductsAnabolic Steroid · Animal Health Products · Ankle Binder
›
Incense & IncensoryAgarbatti · Agarbatti Boxes · Agarbatti Powder
›
Laundry ProductsBelt Hanger · Clothes Pegs · Coat Hanger
›
Medical Equipment3 Ply Face Mask · Absorbent Cotton Wool · Absorbent Gauze Cloth
›
MedicinesAbiraterone Acetate Tablets · Acarbose Tablets · Aceclofenac Sodium
›
Optical Components & OpticsLaser Tubes · Optical Splitter
›
Oral Care ProductsHerbal Tooth Powder · Toothbrush
›
Orthopedic Equipment & SuppliesArtificial Hip Joints · Austin Moore Prosthesis · Bone Saw
›
Poultry, Animal Feed & Bird FoodAlfalfa Hay · Animal Feed · Aqua Feed Supplement
›
Browse subcategories and discover relevant products and verified suppliers.
AdhesivesChemical Adhesive · Teflon Tapes
›
ContainersAluminum Tanks · Blending Storage Tank · Co2 Storage Tank
›
Hologram ProductsStickers
›
Molded PlasticsMolded Plastic Products
›
Packaging MaterialsAcrylic Jars · Aluminium Barrier Foil · Aluminium Ropp Caps
›
Plastic ProductsAbs Granules · Acrylic Sheet · Aluminium Tape
›
Pp & Hdpe SacksGarbage Plastic Bags · Hdpe Laminated Paper Bags · Hdpe Woven Sack Bags
›
Final pricing may vary by order quantity, specification and shipping destination.
Specifications are available from the supplier on request.
Water Treatment Chemicals
Product specifications and commercial details are available from the supplier.
Industry All Categories All Grade Standardv Packaging Size Standard Purity Standard Material Standard
Application Disinfection Brand Ecohealt Products Pvt.Ltd Industry Food & Beverage Categories ETP Treatment Ch…
Packaging Type Plastic can Brand Ecohealt Products Pvt.Ltd Physical State Liquid Color Blue Packaging Size 25…
bmtcxikmklkeklyysaswdlwgnmndqldcsnqxiywpdnjiyikxhpoyexuqjughbsyjfasjbkrgxgyzakkmizbsrmblmgravmazzlvtgqfunosbj…
Apni basic details share karein, phir hamara AI assistant turant help karega.
Loading product…
